Motif Scan in a Protein Sequence

	* Plenty of Jobs Opportunities * Motif Scan in a Protein Sequence result

result

Query

Protein sequence:

>RAW_SEQUENCE
mlqtglakfgshfteaevqqlvnstdvdkngfidygefnvfaqnltieeikgiknifanl
kddnsgtitypdlrssmnqygdpdhsvmsniisevdtdrdgklkydeflttsleqnkmhq
edmllkafkhfdkdhntfinldesetglil

Databases: pattern [Fri Aug 20 18:44:46 1999], profile [PROSITE Release 16.31 + Prerelease Fri Jan 19 18:10:51 2001 ], pfam [Thu Apr 26 00:32:43 2001].

...scanning pattern
...scanning profile
...scanning pfam
...confirming pfam

Result

Scan for pattern:

!/?	match positions	raw score	normalized score	E-value	motif information

`?`	`26-38`	`-`	`-`	`-`	`pat:EF_HAND` EF-hand calcium-binding domain. PS00018 PDOC00018 InterPro.

raw text output explanation of !/?

Scan for profile:

!/?	match positions	raw score	normalized score	E-value	motif information

`!`	`44-112`	`619`	`15.646`	`4.8e-09`	`prf:EF_HAND_2` Ca-binding EF-hand motif. PS50222 PDOC00018 InterPro.
`!`	`1-42`	`362`	`9.403`	`0.0084`

raw text output explanation of !/?

Scan for pfam:

!/?	match positions	raw score	normalized score	E-value	motif information

`!`	`17-45`	`23.1`	`9.507`	`0.0066`	`pfam:EFHAND` EF hand PF00036 Pfam-site InterPro.
`!`	`52-80`	`9.2`	`6.423`	`8`
`!`	`87-115`	`18.6`	`8.150`	`0.15`
`!`	`123-149`	`9.8`	`6.507`	`6.6`

raw text output explanation of !/?

Questions or comments about this page should be sent to Marco Pagni or to Thomas Junier.